PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_09932-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 162aa    MW: 17756.9 Da    PI: 9.6757
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_09932-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.2e-092261847
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     E  l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  TRIUR3_09932-P1 22 ESRLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 61
                     56789999*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.1E-41464IPR001005SANT/Myb domain
PROSITE profilePS512949.2311866IPR017930Myb domain
CDDcd001679.90E-82062No hitNo description
PfamPF002495.2E-72261IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.1E-112264IPR006447Myb domain, plants
SuperFamilySSF466892.65E-112266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-72260IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MVDLMRFVQS AGLEQQQQPE IESRLFLLGL KKYGKGDWRN ISRNFVQTRT PTQVASHAQK  60
YFIRLSSGGG KDKRRSSIHD ITTVHLDDQP PSPSQSSMIT QSSAPAPSPA TGQYSLPADT  120
KQHGGANAPY NSPPSYGMGL QDQGLQCGPL HDQLAANRSM LY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968168.16e-77PREDICTED: transcription factor DIVARICATA
RefseqXP_003568449.17e-77PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-36DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM8ANY01e-118M8ANY0_TRIUA; Transcription factor MYB1R1
STRINGMLOC_20277.17e-93(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-17Homeodomain-like transcriptional regulator